Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Arylsulfatase H (ARSH) antibody

Antigen

Arylsulfatase H (ARSH)

Synonyms sulfatase, ARSH, ARSD, ARSF, LOC100232370
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405680
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Arylsulfatase H
Gene ID ARSH
UniProt Q5FYA8
Immunogen The immunogen for anti-ARSH antibody: synthetic peptide directed towards the middle region of human ARSH
Sequence FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGD NVEEMDWMVG
Cross-Reactivity Dog (Canine), Human, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ARSH antibody concentration is 1 mg/ml.
Description Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [PubMed 16174644]).[supplied by OMIM].
Characteristics Antigen Size: 562 amino acids
Molecular Weight 63kDa

Application Details

Application Notes WB Suggested Anti-ARSH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Sardiello, Annunziata, Roma et al.: "Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship." in: Human molecular genetics, Vol. 14, Issue 21, pp. 3203-17, 2005 (PubMed).

Alternatives

Alternatives for antigen "Arylsulfatase H (ARSH)", type "Antibodies"
Hosts Rabbit (20), Goat (3)
Reactivities Human (20), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), ELISA (6), Western Blotting (WB) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Internal Region (2)