Transmembrane Protein 93 (TMEM93) antibody

Antigen: Transmembrane Protein 93 (TMEM93)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN405687

Additional Information

Alternative name: TMEM93

Gene ID: TMEM93

UniProt: Q9BV81

Immunogen: The immunogen for anti-TMEM93 antibody: synthetic peptide directed towards the N terminal of human TMEM93

Sequence: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATA GILGLTGLYG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM93 antibody concentration is 1 mg/ml.

Description: TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

Characteristics: Antigen Size: 110 amino acids

Molecular Weight: 12kDa

Application Details

Application Notes: WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).