TMEM93 antibody (N-Term)

Catalog No. ABIN635215

Product Details anti-TMEM93 Antibody

Target: TMEM93 (Transmembrane Protein 93 (TMEM93))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM93 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM93 antibody was raised against the N terminal of TMEM93

Purification: Affinity purified

Immunogen: TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM93 Blocking Peptide, catalog no. 33R-1062, is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM93

Target: TMEM93 (Transmembrane Protein 93 (TMEM93))

Alternative Name: TMEM93 (TMEM93 Products)

Synonyms: tmem93 antibody, wu:fb02d05 antibody, zgc:56250 antibody, zgc:77320 antibody, TMEM93 antibody, 0610009E20Rik antibody, 0610025L18Rik antibody, Tmem93 antibody, RGD1309231 antibody, emc6 antibody, transmembrane protein 93 antibody, ER membrane protein complex subunit 6 antibody, ER membrane protein complex subunit 6 S homeolog antibody, CpipJ_CPIJ006367 antibody, CpipJ_CPIJ008001 antibody, Tsp_06149 antibody, EMC6 antibody, emc6 antibody, TMEM93 antibody, Emc6 antibody, emc6.S antibody

Background: TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

Molecular Weight: 12 kDa (MW of target protein)