Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405697

Chromosome 3 Open Reading Frame 17 (C3orf17) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NET17, MGC82019
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405697
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C3orf17 antibody: synthetic peptide directed towards the middle region of human C3orf17
Sequence KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDL YPNSKQLLNS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C3orf17. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C3orf17
Background The function of the C3orf17 protein remains unknown.
Molecular Weight 49kDa
Gene ID 25871
NCBI Accession NP_001020243, NM_001025072
UniProt A8MVI8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C3orf17 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Alternatives for antigen "Chromosome 3 Open Reading Frame 17 (C3orf17)", type "Antibodies"
Hosts (17), (1)
Reactivities (16), (12), (12), (12)
Applications (10), (9), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon