Chromosome 3 Open Reading Frame 17 (C3orf17) (Middle Region) antibody

Details for Product No. ABIN405698
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms NET17, MGC82019
Epitope
Middle Region
(2), (1), (1)
Reactivity
Human
(16), (12), (12), (12)
Host
Rabbit
(17), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN405698
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C3orf17
Sequence KQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTVMQI NKNSTSGTIK
Predicted Reactivity Human : 100 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against C3orf17. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C3orf17
Background The function of the C3orf17 protein remains unknown.
Molecular Weight 64 kDa
Gene ID 25871
NCBI Accession NM_015412, NP_056227
UniProt Q6NW34
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 567 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 3 Open Reading Frame 17 (C3orf17) (Middle Region) antibody WB Suggested Anti-C3orf17 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Hosts (17), (1)
Reactivities (16), (12), (12), (12)
Applications (10), (9), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
back to top