KIAA0317 (KIAA0317) antibody

Antigen: KIAA0317 (KIAA0317)

Synonyms: AI649076, AW610792, Kiaa0317, mKIAA0317, MGC114730

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN405711

Additional Information

Alternative name: KIAA0317

Gene ID: KIAA0317

UniProt: O15033

Immunogen: The immunogen for anti-KIAA0317 antibody: synthetic peptide directed towards the middle region of human KIAA0317

Sequence: VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILN NDMSEMELVF

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KIAA0317 antibody concentration is 1 mg/ml.

Description: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

Characteristics: Antigen Size: 823 amino acids

Molecular Weight: 94kDa

Application Details

Application Notes: WB Suggested Anti-KIAA0317 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin

Restrictions: For Research Use only

Images

WB Suggested Anti-KIAA0317 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart

Publications

Product: Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).