Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B) antibody

Antigen: Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN405769

Additional Information

Alternative name: RRP1B

Gene ID: RRP1B

UniProt: Q14684

Immunogen: The immunogen for anti-RRP1B antibody: synthetic peptide directed towards the middle region of human RRP1B

Sequence: VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLH GVLKTPTSSP

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RRP1B antibody concentration is 1 mg/ml.

Description: RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.

Characteristics: Antigen Size: 758 amino acids

Molecular Weight: 84kDa

Application Details

Application Notes: WB Suggested Anti-RRP1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Transcription Factors, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-RRP1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

anti-Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B) antibody (Image 2)

Publications

Product: Crawford, Qian, Ziogas et al.: "Rrp1b, a new candidate susceptibility gene for breast cancer progression and metastasis." in: PLoS genetics, Vol. 3, Issue 11, pp. e214, 2007 (PubMed).