Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405771

Chromosome 21 Open Reading Frame 62 (C21orf62) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B37, PRED81, C21orf120, MGC88933
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405771
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C21orf62 antibody: synthetic peptide directed towards the middle region of human C21orf62
Sequence STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGD SDSREKPMWL
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against C21orf62. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C21orf62
Background The exact function of C21orf62 remains unknown.
Molecular Weight 28kDa
Gene ID 56245
NCBI Accession NP_062542, NM_019596
UniProt Q9NYP8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C21orf62 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Alternatives for antigen "Chromosome 21 Open Reading Frame 62 (C21orf62)", type "Antibodies"
Hosts (14)
Reactivities (13), (12), (12)
Applications (10), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon