Chromosome 21 Open Reading Frame 62 (C21orf62) (Middle Region) antibody

Details for Product No. ABIN405771
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B37, PRED81, C21orf120, MGC88933
Epitope
Middle Region
(1)
Reactivity
Human
(14), (12), (12)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN405771
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C21orf62
Sequence STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGD SDSREKPMWL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against C21orf62. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C21orf62
Background The exact function of C21orf62 remains unknown.
Molecular Weight 28 kDa
Gene ID 56245
NCBI Accession NM_019596, NP_062542
UniProt Q9NYP8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 247 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 21 Open Reading Frame 62 (C21orf62) (Middle Region) antibody WB Suggested Anti-C21orf62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate
Background publications Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Hosts (14), (1)
Reactivities (14), (12), (12)
Applications (10), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top