Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 21 Open Reading Frame 62 (C21orf62) antibody

Antigen

Chromosome 21 Open Reading Frame 62 (C21orf62)

Synonyms B37, PRED81, C21orf120, MGC88933
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405771
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C21orf62
Gene ID C21orf62
UniProt Q9NYP8
Immunogen The immunogen for anti-C21orf62 antibody: synthetic peptide directed towards the middle region of human C21orf62
Sequence STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGD SDSREKPMWL
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C21orf62 antibody concentration is 1 mg/ml.
Description The exact function of C21orf62 remains unknown.
Characteristics Antigen Size: 247 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-C21orf62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 21 Open Reading Frame 62 (C21orf62)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1)