Chromosome 21 Open Reading Frame 59 (C21orf59) antibody

Antigen: Chromosome 21 Open Reading Frame 59 (C21orf59)

Synonyms: C21orf48, FLJ20467, FLJ37137, FLJ40247, MGC83493, C21orf59, RA_m005_jsm24C07r, C3H21orf59

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN405773

Additional Information

Alternative name: C21orf59

Gene ID: C21orf59

UniProt: P57076

Immunogen: The immunogen for anti-C21orf59 antibody: synthetic peptide directed towards the N terminal of human C21orf59

Sequence: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKV QRLCSEMEEL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C21orf59 antibody concentration is 1 mg/ml.

Description: The function of the C21orf59 protein remains unknown.

Characteristics: Antigen Size: 290 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-C21orf59 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C21orf59 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

anti-Chromosome 21 Open Reading Frame 59 (C21orf59) antibody (Image 2)

Publications

Product: Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).