Src Kinase Associated phosphoprotein 1 (SKAP1) antibody

Antigen: Src Kinase Associated phosphoprotein 1 (SKAP1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN405786

Additional Information

Alternative name: SCAP1 / SKAP55

Gene ID: SKAP1

UniProt: Q86WV1

Immunogen: The immunogen for anti-SKAP1 antibody: synthetic peptide directed towards the N terminal of human SKAP1

Sequence: RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLG LSLTSDAPFL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SKAP1 antibody concentration is 1 mg/ml.

Description: SKAP1 Is a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

Characteristics: Antigen Size: 359 amino acids

Molecular Weight: 41kDa

Application Details

Application Notes: WB Suggested Anti-SKAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SKAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Kosco, Cerignoli, Williams et al.: "SKAP55 modulates T cell antigen receptor-induced activation of the Ras-Erk-AP1 pathway by binding RasGRP1." in: Molecular immunology, Vol. 45, Issue 2, pp. 510-22, 2007 (PubMed).