SKAP1 antibody (N-Term)

Catalog No. ABIN634334

Product Details anti-SKAP1 Antibody

Target: SKAP1 (Src Kinase Associated phosphoprotein 1 (SKAP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SKAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SKAP1 antibody was raised against the N terminal of SKAP1

Purification: Affinity purified

Immunogen: SKAP1 antibody was raised using the N terminal of SKAP1 corresponding to a region with amino acids RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SKAP1 Blocking Peptide, catalog no. 33R-7848, is also available for use as a blocking control in assays to test for specificity of this SKAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SKAP1

Target: SKAP1 (Src Kinase Associated phosphoprotein 1 (SKAP1))

Alternative Name: SKAP1 (SKAP1 Products)

Synonyms: 1700091G21Rik antibody, Scap1 antibody, Skap-55 antibody, SCAP1 antibody, SKAP55 antibody, Skap55 antibody, src family associated phosphoprotein 1 antibody, src kinase associated phosphoprotein 1 antibody, Skap1 antibody, SKAP1 antibody

Background: SKAP1 Is a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

Molecular Weight: 41 kDa (MW of target protein)