Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Heat Shock 70kDa Protein 4 (HSPA4) antibody

Antigen

Heat Shock 70kDa Protein 4 (HSPA4)
Synonyms DKFZp459F0933
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Rat (Rattus), Xenopus laevis, Chicken, Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405790
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Heat Shock 70kDa Protein 4 (HSPA4) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name HSPA4 / APG2
Gene ID HSPA4
UniProt P34932
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the N terminal of human HSPA4
Sequence PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAF SDPFVEAEKS
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-HSPA4 antibody concentration is 1 mg/ml.
Description HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.
Characteristics Antigen Size: 840 amino acids
Molecular Weight 94kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-HSPA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Kim, Jiang, Du et al.: "PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1." in: Molecular cell, Vol. 30, Issue 2, pp. 239-47, 2008 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Heat Shock 70kDa Protein 4 (HSPA4)", type "Antibodies"
Hosts Rabbit (76), Mouse (46), Chicken (2)
Reactivities Human (117), Mouse (Murine) (71), Rat (Rattus) (69), Chicken (34), Dog (Canine) (33), Pig (Porcine) (31), Cow (Bovine) (26), Fruit Fly (Drosophila melanogaster) (23), Monkey (20), Fish (19), Hamster (18), Guinea Pig (15), Rabbit (14), Sheep (Ovine) (14), Amphibian (13), Carp (8), Bird (Avian) (6), Caenorhabditis elegans (C. elegans) (6), Saccharomyces cerevisiae (S. cerevisiae) (5), Xenopus laevis (3), Yeast (3), Yeast (Pichia pastoris) (3), Yeast (Saccharomyces cerevisiae) (3), Beluga (2), Coral (2), Tomato (Solanum lycopersicum) (2), Trout (2), Zebrafish (2), Acanthamoeba castellani (1), Algae (Desmodesmus subspicatus) (1), Arabidopsis thaliana (1), Atlantic Hagfish (Myxine glutinosa) (1), Barley (Hordeum vulgare) (1), Cat (Feline) (1), Geodia cydonium (1), Maize/Corn (Zea mays) (1), Mummichog (1), Plant (1), Primate (1), Rainbow Trout (Oncorhynchus mykiss) (1), Salmon (Salmonidae) (1), Seal (Pinnipedia) (1), Tobacco (Nicotiana tabacum) (1)
Applications Western Blotting (WB) (94), ELISA (53), Immunofluorescence (IF) (42), Immunoprecipitation (IP) (31), Immunohistochemistry (IHC) (30), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (27), Immunocytochemistry (ICC) (23), Flow Cytometry (FACS) (14), Immunohistochemistry (Frozen Sections) (IHC (fro)) (11), Immunoelectron Microscopy (IEM) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Fluorescence Microscopy (FM) (1)
Conjugates FITC (5), Biotin (3), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), PE,Cy5.5 (2), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes pTyr41 (4), pTyr525 (4), C-Term (3), AA 436-503 (2), Internal Region (2), AA 1-641 (1), Center (1), Cytoplasmic (1), N-Term (1), pSer254 (1), pSer307 (1)