Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Nucleolar and Spindle Associated Protein 1 (NUSAP1) antibody

Antigen

Nucleolar and Spindle Associated Protein 1 (NUSAP1)
Synonyms LNP, ANKT, SAPL, BM037, NUSAP, Q0310, FLJ13421, PRO0310p1, NuSAP, AI481307, AW547774, BB165529, 2610201A12Rik
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish, Chicken
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405803
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Nucleolar and Spindle Associated Protein 1 (NUSAP1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name NUSAP1 / ANKT
Gene ID NUSAP1
Immunogen The immunogen for anti-NUSAP1 antibody: synthetic peptide directed towards the C terminal of human NUSAP1
Sequence LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFY KKTYKQPHLQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-NUSAP1 antibody concentration is 1 mg/ml.
Description NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
Characteristics Antigen Size: 226 amino acids
Molecular Weight 25kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-NUSAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Raemaekers, Ribbeck, Beaudouin et al.: "NuSAP, a novel microtubule-associated protein involved in mitotic spindle organization." in: The Journal of cell biology, Vol. 162, Issue 6, pp. 1017-29, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Nucleolar and Spindle Associated Protein 1 (NUSAP1)", type "Antibodies"
Hosts Rabbit (34)
Reactivities Human (32), Mouse (Murine) (21), Rat (Rattus) (19), Chicken (18), Pig (Porcine) (17), Cat (Feline) (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (19), Immunofluorescence (IF) (18), ELISA (15), Immunohistochemistry (IHC) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (5), Internal Region (1), N-Term (1), Nucleolar (1)