Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405854

Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Il1rl1l, Ly84l, St2l, IL1RL1LG, Tp24
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405854
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMED1 antibody: synthetic peptide directed towards the middle region of human TMED1
Sequence FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSF STISEKLVFF
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against TMED1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMED1
Background TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.
Molecular Weight 23kDa
Gene ID 11018
NCBI Accession NP_006849, NM_006858
UniProt Q13445
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMED1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1)", type "Antibodies"
Hosts (10), (5)
Reactivities (14), (3)
Applications (15), (2), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon