Transmembrane Protein 115 (TMEM115) antibody

Antigen: Transmembrane Protein 115 (TMEM115)

Synonyms: PL6, TMEM115, MGC137897, RGD1310540, MGC114074, MGC123241, wu:fc43c03, wu:fd18h12, zgc:114074

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN405856

Additional Information

Alternative name: TMEM115 / PL6

Gene ID: TMEM115

UniProt: Q12893

Immunogen: The immunogen for anti-TMEM115 antibody: synthetic peptide directed towards the N terminal of human TMEM115

Sequence: LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWD VAISLTTVVV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM115 antibody concentration is 1 mg/ml.

Description: The specific function of TMEM115 is not yet known.

Characteristics: Antigen Size: 351 amino acids

Molecular Weight: 38kDa

Application Details

Application Notes: WB Suggested Anti-TMEM115 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM115 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Publications

Product: Muzny, Scherer, Kaul et al.: "The DNA sequence, annotation and analysis of human chromosome 3." in: Nature, Vol. 440, Issue 7088, pp. 1194-8, 2006 (PubMed).