TMEM115 antibody (N-Term)
-
- Target See all TMEM115 Antibodies
- TMEM115 (Transmembrane Protein 115 (TMEM115))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM115 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM115 antibody was raised against the N terminal of TMEM115
- Purification
- Affinity purified
- Immunogen
- TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV
- Top Product
- Discover our top product TMEM115 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM115 Blocking Peptide, catalog no. 33R-5190, is also available for use as a blocking control in assays to test for specificity of this TMEM115 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM115 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM115 (Transmembrane Protein 115 (TMEM115))
- Alternative Name
- TMEM115 (TMEM115 Products)
- Synonyms
- TMEM115 antibody, PL6 antibody, wu:fc43c03 antibody, wu:fd18h12 antibody, zgc:114074 antibody, C78915 antibody, Pl6 antibody, Pp6 antibody, RGD1310540 antibody, transmembrane protein 115 antibody, transmembrane protein 115 S homeolog antibody, TMEM115 antibody, CpipJ_CPIJ001136 antibody, CpipJ_CPIJ014350 antibody, MCYG_03262 antibody, MGYG_00421 antibody, tmem115.S antibody, tmem115 antibody, Tmem115 antibody
- Background
- The specific function of TMEM115 is not yet known.
- Molecular Weight
- 38 kDa (MW of target protein)
-