UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5) antibody

Antigen: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN405869

Additional Information

Alternative name: GALNT5

Gene ID: GALNT5

UniProt: Q7Z7M9

Immunogen: The immunogen for anti-GALNT5 antibody: synthetic peptide directed towards the middle region of human GALNT5

Sequence: ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKT VERNLVRVAE

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GALNT5 antibody concentration is 1 mg/ml.

Description: GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.

Characteristics: Antigen Size: 940 amino acids

Molecular Weight: 106kDa

Application Details

Application Notes: WB Suggested Anti-GALNT5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Organelles, Extracellular Matrix

Restrictions: For Research Use only

Images

WB Suggested Anti-GALNT5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

Publications

Product: Simmons, Musy, Lopes et al.: "A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses." in: Human molecular genetics, Vol. 8, Issue 12, pp. 2155-64, 1999 (PubMed).