Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 2 Open Reading Frame 18 (C2orf18) antibody

Antigen

Chromosome 2 Open Reading Frame 18 (C2orf18)

Synonyms ANT2BP, FLJ20555, C13H2orf18, DKFZp469D0310
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405897
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C2orf18
Gene ID C2orf18
UniProt Q8N357
Immunogen The immunogen for anti-C2orf18 antibody: synthetic peptide directed towards the middle region of human C2orf18
Sequence GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQ VGQQPLIAVA
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C2orf18 antibody concentration is 1 mg/ml.
Description The exact function of C2orf18 remains unknown.
Characteristics Antigen Size: 371 amino acids
Molecular Weight 40kDa

Application Details

Application Notes WB Suggested Anti-C2orf18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer
Restrictions For Research Use only

Publications

Product Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 2 Open Reading Frame 18 (C2orf18)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (1), C-Term,AA 336-366 (1), Internal Region (1)