Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405905

Anoctamin 10 (ANO10) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SCAR10, TMEM16K, AI604832, Tmem16k, RGD1308260, tmem16k, ano10, zgc:114140
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405905
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM16K antibody: synthetic peptide directed towards the C terminal of human TMEM16K
Sequence LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVS LFSCVYPLAA
Predicted Reactivity Bovine :100%,   Human :100%,   Mouse :100%,   African clawed frog :100%,   Green puffer :100%,   Rat :100%,   Zebrafish :92%,   Florida lancelet :91%,   Phytophthora infestans T30-4 :84%,   Red flour beetle :83%,  
Characteristics This is a rabbit polyclonal antibody against TMEM16K. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM16K
Background TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.
Molecular Weight 76kDa
Gene ID 55129
NCBI Accession NP_060545, NM_018075
UniProt Q9NW15
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM16K antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Anoctamin 10 (ANO10)", type "Antibodies"
Hosts (6), (1)
Reactivities (6), (1), (1), (1), (1), (1)
Applications (7), (3), (2)
Epitopes (2), (2), (2), (1), (1)
Beacon