Did you know that you can buy products from over 140 different suppliers from us?

Anoctamin 10 (ANO10) (C-Term) antibody

Details for Product No. ABIN405905
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SCAR10, TMEM16K, AI604832, Tmem16k, RGD1308260, tmem16k, ano10, zgc:114140
Epitope
C-Term
(2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(7), (1), (1), (1), (1), (1)
Host
Rabbit
(6), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405905
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TMEM16K
Sequence LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVS LFSCVYPLAA
Predicted Reactivity Bovine :100 %,   Human :100 %,   Mouse :100 %,   African clawed frog :100 %,   Green puffer :100 %,   Rat :100 %,   Zebrafish :90 %,   Florida lancelet :90 %,   Phytophthora infestans T30-4 :80 %,   Red flour beetle :80 %,  
Characteristics This is a rabbit polyclonal antibody against TMEM16K. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM16K
Background TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.
Molecular Weight 76 kDa
Gene ID 55129
NCBI Accession NM_018075, NP_060545
UniProt Q9NW15
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 660 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Anoctamin 10 (ANO10) (C-Term) antibody WB Suggested Anti-TMEM16K Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405905
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top