Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405951

Placenta-Specific 9 (PLAC9) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Plac9
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405951
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PLAC9 antibody: synthetic peptide directed towards the middle region of human PLAC9
Sequence RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPF SPAPDLLGDG
Predicted Reactivity Human : 100%, Bovine : 92%, Pig : 92%, Mouse : 86%, Rat : 86%
Characteristics This is a rabbit polyclonal antibody against PLAC9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PLAC9
Background The exact function of PLAC9 remains unknown.
Molecular Weight 10kDa
Gene ID 219348
NCBI Accession NP_001012991, NM_001012973
UniProt Q5JTB6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PLAC9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Placenta-Specific 9 (PLAC9)", type "Antibodies"
Hosts (6)
Reactivities (5)
Applications (6), (5), (2), (2), (2), (2)
Conjugates (2)
Epitopes (2), (1)
Beacon