Did you know that you can buy products from over 140 different suppliers from us?

Placenta-Specific 9 (PLAC9) (Middle Region) antibody

Details for Product No. ABIN405951
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Plac9
Epitope
Middle Region
(3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(6)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2)
Application
Western Blotting (WB)
(7), (5), (3), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405951
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PLAC9
Sequence RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPF SPAPDLLGDG
Predicted Reactivity Human : 100 %, Bovine : 90 %, Pig : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against PLAC9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PLAC9
Background The exact function of PLAC9 remains unknown.
Molecular Weight 10 kDa
Gene ID 219348
NCBI Accession NM_001012973, NP_001012991
UniProt Q5JTB6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 97 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405951
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top