Chromosome 1 Open Reading Frame 111 (C1orf111) (Middle Region) antibody

Details for Product No. ABIN405956
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RP11-565P22.3
Epitope
Middle Region
(2)
Reactivity
Dog (Canine), Cow (Bovine), Human
(27), (24), (24), (24), (12)
Host
Rabbit
(28), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(20), (11), (6), (6), (1)
Pubmed 1 reference available
Catalog no. ABIN405956
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C1orf111
Sequence CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLR QIGGEAYLCL
Predicted Reactivity Dog : 100 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against C1orf111. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C1orf111
Background The function of the C1orf111 protein remains unknown.
Molecular Weight 29 kDa
Gene ID 284680
NCBI Accession NM_182581, NP_872387
UniProt Q5T0L3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 261 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Hosts (28), (1)
Reactivities (27), (24), (24), (24), (12)
Applications (20), (11), (6), (6), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (2)
back to top