Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405956

Chromosome 1 Open Reading Frame 111 (C1orf111) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RP11-565P22.3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405956
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1orf111 antibody: synthetic peptide directed towards the middle region of human C1orf111
Sequence CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLR QIGGEAYLCL
Predicted Reactivity Dog : 100%, Horse : 92%, Pig : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against C1orf111. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1orf111
Background The function of the C1orf111 protein remains unknown.
Molecular Weight 29kDa
Gene ID 284680
NCBI Accession NP_872387, NM_182581
UniProt Q5T0L3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1orf111 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Chromosome 1 Open Reading Frame 111 (C1orf111)", type "Antibodies"
Hosts (29)
Reactivities (27), (24), (24), (24), (12)
Applications (20), (11), (7), (6)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (2), (1)
Beacon