Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405957

SRR1 Domain Containing (SRRD) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810002G02Rik, Srr1, HC/HCC, SRR1L
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405957
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SRRD antibody: synthetic peptide directed towards the middle region of human SRRD
Sequence DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEI IRNKREDPSA
Predicted Reactivity Human : 100%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against SRRD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SRRD
Background SRRD belongs to the SRR1 family. It may be involved in a circadian clock input pathway.
Molecular Weight 38kDa
Gene ID 402055
NCBI Accession NP_001013716, NM_001013694
UniProt Q9UH36
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SRRD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dunham, Shimizu, Roe et al.: "The DNA sequence of human chromosome 22." in: Nature, Vol. 402, Issue 6761, pp. 489-95, 1999 (PubMed).

Alternatives for antigen "SRR1 Domain Containing (SRRD)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5), (1)
Epitopes (2), (2), (1), (1)
Beacon