Did you know that you can buy products from over 140 different suppliers from us?

SRR1 Domain Containing (SRRD) (Middle Region) antibody

Details for Product No. ABIN405957
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HC/HCC, SRR1L, 2810002G02Rik, Srr1
Epitope
Middle Region
(7), (7), (2), (1)
Reactivity
Human
(10)
Host
Rabbit
(11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (6)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405957
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SRRD
Sequence DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEI IRNKREDPSA
Predicted Reactivity Human : 100 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against SRRD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SRRD
Background SRRD belongs to the SRR1 family. It may be involved in a circadian clock input pathway.
Molecular Weight 38 kDa
Gene ID 402055
NCBI Accession NM_001013694, NP_001013716
UniProt Q9UH36
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 339 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SRR1 Domain Containing (SRRD) (Middle Region) antibody WB Suggested Anti-SRRD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-SRR1 Domain Containing (SRRD) (Middle Region) antibody (2) Host: Rabbit
Target Name: SRRD
Sample Tissue: 721_B
Antibody Dilution: 1.0 µg/mL SRRD is supported by BioGPS gene expression data to be expressed in 721_B
Background publications Dunham, Shimizu, Roe et al.: "The DNA sequence of human chromosome 22. ..." in: Nature, Vol. 402, Issue 6761, pp. 489-95, 1999 (PubMed).

Validation Images
back to top