Did you know that you can buy products from over 140 different suppliers from us?

Glioblastoma Amplified Sequence (GBAS) (Middle Region) antibody

Details for Product No. ABIN405973
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NIPSNAP2, AV006093, Nipsnap2, nipsnap2, zgc:92497, wu:fc08b08
Epitope
Middle Region
(9), (8), (7), (4), (4), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(44), (27), (27), (12), (12)
Host
Rabbit
(45), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(36), (28), (20), (10), (10), (9), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405973
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GBAS
Sequence VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNE AVGGFFSQIG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Rabbit : 100 %, Chicken : 90 %, Guinea pig : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against GBAS. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GBAS
Background Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40 % of glioblastomas, the most common and malignant form of central nervous system tumor.The predicted 286-amino acid protein contains a signal peptide, a transmembrane domain, and 2 tyrosine phosphorylation sites. The GBAS transcript is expressed most abundantly in heart and skeletal muscle. GBAS protein might be involved in vesicular transport.Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40 % of glioblastomas, the most common and malignant form of central nervous system tumor.The predicted 286-amino acid protein contains a signal peptide, a transmembrane domain, and 2 tyrosine phosphorylation sites. The GBAS transcript is expressed most abundantly in heart and skeletal muscle. GBAS protein might be involved in vesicular transport.
Molecular Weight 34 kDa
Gene ID 2631
NCBI Accession NM_001483, NP_001474
UniProt O75323
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 286 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glioblastoma Amplified Sequence (GBAS) (Middle Region) antibody WB Suggested Anti-GBAS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: THP-1 cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (45), (1)
Reactivities (44), (27), (27), (12), (12)
Applications (36), (28), (20), (10), (10), (9), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (7), (4), (4), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405973
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top