NudC Domain Containing 1 (NUDCD1) antibody

Antigen: NudC Domain Containing 1 (NUDCD1)

Synonyms: Cml66, CML66-L, AA407246, AW260430, AW556235, 4921532K09Rik, CML66, OVA66, FLJ14991, RGD1310624, cml66, MGC69032, MGC110705, im:6901299, im:6912119, wu:fc11c02, zgc:110705

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN405988

Additional Information

Alternative name: NUDCD1 / CML66

Gene ID: NUDCD1

UniProt: Q96RS6

Immunogen: The immunogen for anti-NUDCD1 antibody: synthetic peptide directed towards the N terminal of human NUDCD1

Sequence: EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAV AEVKLRDDQY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NUDCD1 antibody concentration is 1 mg/ml.

Description: NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Characteristics: Antigen Size: 583 amino acids

Molecular Weight: 67kDa

Application Details

Application Notes: WB Suggested Anti-NUDCD1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NUDCD1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta

Publications

Product: Yan, Phan, Yang et al.: "A novel mechanism of alternative promoter and splicing regulates the epitope generation of tumor antigen CML66-L." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 172, Issue 1, pp. 651-60, 2003 (PubMed).

Zhu, Hart, Chang et al.: "Analysis of the major patterns of B cell gene expression changes in response to short-term stimulation with 33 single ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 173, Issue 12, pp. 7141-9, 2004 (PubMed).