Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2) antibody

Antigen: Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2)

Synonyms: GCK, BL44, RAB8IP

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN406003

Additional Information

Alternative name: MAP4K2

Gene ID: MAP4K2

UniProt: Q12851

Immunogen: The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2

Sequence: HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALT KNPKKRPTAE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MAP4K2 antibody concentration is 1 mg/ml.

Description: MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.The protein encoded by this gene is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Characteristics: Antigen Size: 820 amino acids

Molecular Weight: 91kDa

Application Details

Application Notes: WB Suggested Anti-MAP4K2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MAP4K2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Publications

Product: Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).