Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F) antibody

Antigen

Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F)

Synonyms RPC6, RPC39, MGC13517, MGC11656, 2810411G20Rik, 3010019O03Rik, 3110032A07Rik, MGC134486
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406011
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name POLR3F
Gene ID POLR3F
UniProt Q9H1D9
Immunogen The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F
Sequence LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKY ICELGISKVE
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-POLR3F antibody concentration is 1 mg/ml.
Description POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.The protein encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.
Characteristics Antigen Size: 316 amino acids
Molecular Weight 36kDa

Application Details

Application Notes WB Suggested Anti-POLR3F Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives

Alternatives for antigen "Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F)", type "Antibodies"
Hosts Rabbit (16)
Reactivities Human (12), Mouse (Murine) (8), Rat (Rattus) (8), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (15), ELISA (8), Immunohistochemistry (IHC) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3)
Epitopes N-Term (4), 1st Cytoplasmic Loop (1), Internal Region (1)