Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F) antibody

Antigen: Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F)

Synonyms: RPC6, RPC39, MGC13517, MGC11656, 2810411G20Rik, 3010019O03Rik, 3110032A07Rik, MGC134486

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN406011

Additional Information

Alternative name: POLR3F

Gene ID: POLR3F

UniProt: Q9H1D9

Immunogen: The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F

Sequence: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKY ICELGISKVE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-POLR3F antibody concentration is 1 mg/ml.

Description: POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.The protein encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.

Characteristics: Antigen Size: 316 amino acids

Molecular Weight: 36kDa

Application Details

Application Notes: WB Suggested Anti-POLR3F Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-POLR3F Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).