Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406077

Transmembrane Protein 168 (TMEM168) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI462344, AI504145, 5730526F17Rik, 8430437G11Rik, RGD1307778, flj13576, tmem168, si:dkey-192l17.1, DKFZp469K0515
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406077
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM168 antibody: synthetic peptide directed towards the C terminal of human TMEM168
Sequence EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYG VSKRWSDYTL
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against TMEM168. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM168
Background TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.
Molecular Weight 80kDa
Gene ID 64418
NCBI Accession NP_071929, NM_022484
UniProt Q9H0V1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM168 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Simpson, Wellenreuther, Poustka et al.: "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing." in: EMBO reports, Vol. 1, Issue 3, pp. 287-92, 2001 (PubMed).

Alternatives for antigen "Transmembrane Protein 168 (TMEM168)", type "Antibodies"
Hosts (4)
Reactivities (3)
Applications (4), (2), (2)
Epitopes (3), (2)
Beacon