Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406080

UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GALNT15, GalNac-T10, GalNac-T14, si:ch211-147c1.1, 0610033M06Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN406080
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GALNT14 antibody: synthetic peptide directed towards the middle region of human GALNT14
Sequence LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVW MDEYKQYYYA
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Chicken : 92%, Zebrafish : 85%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against GALNT14. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GALNT14
Background GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates. GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.
Molecular Weight 64kDa
Gene ID 79623
NCBI Accession NP_078848, NM_024572
UniProt Q96FL9
Research Area Signaling, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GALNT14 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Xu, Chen, Zhang et al.: "Correlation between hand and total body bone density in normal Chinese children." in: Bone, Vol. 41, Issue 3, pp. 360-5, 2007 (PubMed).

Background publications Wu, Yao, Zou et al.: "N-Acetylgalactosaminyltransferase 14, a novel insulin-like growth factor binding protein-3 binding partner." in: Biochemical and biophysical research communications, Vol. 357, Issue 2, pp. 360-5, 2007 (PubMed).

Alternatives for antigen "UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14)", type "Antibodies"
Hosts (22), (3)
Reactivities (24), (14), (14)
Applications (16), (10), (7), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (3), (2), (1), (1), (1)
Beacon