Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 10 Open Reading Frame 57 (C10ORF57) (Middle Region) antibody

Details for Product No. ABIN406087
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC131362, C10orf57, bA369J21.6
Epitope
Middle Region
(8), (7), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(9)
Host
Rabbit
(10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (6), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406087
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C10orf57
Sequence QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGE SLYAIVLCKH
Predicted Reactivity Human : 100 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against C10orf57. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C10orf57
Background The exact function of C10orf57 is not known.
Molecular Weight 14 kDa
Gene ID 80195
NCBI Accession NM_025125, NP_079401
UniProt Q8TBM7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 123 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 10 Open Reading Frame 57 (C10ORF57) (Middle Region) antibody WB Suggested Anti-C10orf57 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Validation Images
back to top