Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406093

Tetraspanin 10 (TSPAN10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OCSP, Ocsp, GB13074
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406093
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TSPAN10 antibody: synthetic peptide directed towards the N terminal of human TSPAN10
Sequence SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLG GPLPADPMLG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against TSPAN10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TSPAN10
Background TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.
Molecular Weight 37kDa
Gene ID 83882
NCBI Accession NP_114151, NM_031945
UniProt Q9H1Z9
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TSPAN10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wistow, Bernstein, Wyatt et al.: "Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants." in: Molecular vision, Vol. 8, pp. 205-20, 2002 (PubMed).

Alternatives for antigen "Tetraspanin 10 (TSPAN10)", type "Antibodies"
Hosts (19)
Reactivities (18), (17), (17)
Applications (15), (10), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon