Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406104

Transmembrane Protein 132B (TMEM132B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AK220418, mKIAA1786, RGD1566191
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406104
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM132B antibody: synthetic peptide directed towards the middle region of human TMEM132B
Sequence VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPD AFTSFPTQGK
Predicted Reactivity Horse : 92%, Bovine : 85%, Dog : 85%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against TMEM132B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM132B
Background TMEM132B single-pass type I membrane protein. It belongs to the TMEM132 family. The exact function of TMEM132B is not known.
Molecular Weight 119kDa
Gene ID 114795
NCBI Accession NP_443139, NM_052907
UniProt Q14DG7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM132B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Transmembrane Protein 132B (TMEM132B)", type "Antibodies"
Hosts (5)
Reactivities (2), (2)
Applications (5), (1)
Epitopes (1)
Beacon