Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406138

Scratch Homolog 2, Zinc Finger Protein (Drosophila) (SCRT2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF898B, AW060659
Epitope
Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406138
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SCRT2 antibody: synthetic peptide directed towards the middle region of human SCRT2
Sequence HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEP PPPTPAGPAS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SCRT2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SCRT2
Background SCRT2 belongs to the snail C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers. SCRT2 may be involved in transcriptional regulation.
Molecular Weight 32kDa
Gene ID 85508
NCBI Accession NP_149120, NM_033129
UniProt Q9NQ03
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SCRT2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "Scratch Homolog 2, Zinc Finger Protein (Drosophila) (SCRT2)", type "Antibodies"
Hosts (1)
Reactivities (1)
Applications (1)
Beacon