Scratch Homolog 2, Zinc Finger Protein (Drosophila) (SCRT2) (Middle Region) antibody

Details for Product No. ABIN406138
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ZNF898B, AW060659
Epitope
Middle Region
Reactivity
Human
(1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN406138
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SCRT2
Sequence HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEP PPPTPAGPAS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SCRT2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SCRT2
Background SCRT2 belongs to the snail C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers. SCRT2 may be involved in transcriptional regulation.
Molecular Weight 32 kDa
Gene ID 85508
NCBI Accession NM_033129, NP_149120
UniProt Q9NQ03
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 307 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Scratch Homolog 2, Zinc Finger Protein (Drosophila) (SCRT2) (Middle Region) antibody WB Suggested Anti-SCRT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Hosts (1)
Reactivities (1)
Applications (1)
back to top