5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS) antibody

Antigen: 5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS)

Synonyms: FLJ30410, HsT19268, AI119695, 1110034I12Rik, 2310020H23Rik, MGC95139, MTHFS

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN406202

Additional Information

Alternative name: MTHFS

Gene ID: MTHFS

UniProt: P49914

Immunogen: The immunogen for anti-MTHFS antibody: synthetic peptide directed towards the middle region of human MTHFS

Sequence: TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRL GRGKGYYDAY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MTHFS antibody concentration is 1 mg/ml.

Description: The exact function of MTHFS remains unknown.

Characteristics: Antigen Size: 203 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-MTHFS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-MTHFS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Publications

Product: Lee, Lan, Kricker et al.: "One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia." in: Human genetics, Vol. 122, Issue 5, pp. 525-33, 2007 (PubMed).