Did you know that you can buy products from over 140 different suppliers from us?

Kelch-Like 32 (Drosophila) (KLHL32) (Middle Region) antibody

Details for Product No. ABIN406217
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 6430524H05Rik, D4Ertd389e, Gm1356, mKIAA1900, zgc:158866, BKLHD5, KIAA1900, UG0030H05, dJ21F7.1, RGD1310364
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(5), (2), (2)
Host
Rabbit
(4), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (2), (2), (2)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406217
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KLHL32
Sequence DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQT LQVPHHRIGT
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against KLHL32. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KLHL32
Background The specific function of KLHL32 is not yet known.
Molecular Weight 70 kDa
Gene ID 114792
NCBI Accession NM_052904, NP_443136
UniProt Q96NJ5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 620 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like 32 (Drosophila) (KLHL32) (Middle Region) antibody WB Suggested Anti-KLHL32 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top