Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406217

Kelch-Like 32 (Drosophila) (KLHL32) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BKLHD5, KIAA1900, UG0030H05, dJ21F7.1, zgc:158866, 6430524H05Rik, D4Ertd389e, Gm1356, mKIAA1900, RGD1310364
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN406217
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KLHL32 antibody: synthetic peptide directed towards the middle region of human KLHL32
Sequence DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQT LQVPHHRIGT
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against KLHL32. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KLHL32
Background The specific function of KLHL32 is not yet known.
Molecular Weight 70kDa
Gene ID 114792
NCBI Accession NP_443136, NM_052904
UniProt Q96NJ5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KLHL32 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Kelch-Like 32 (Drosophila) (KLHL32)", type "Antibodies"
Hosts (4), (1)
Reactivities (4), (2), (2)
Applications (3), (3), (2), (1)
Epitopes (1), (1)
Beacon