Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 20 Open Reading Frame 160 (C20orf160) antibody

Antigen

Chromosome 20 Open Reading Frame 160 (C20orf160)

Synonyms FLJ43600, dJ310O13.5
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406221
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C20orf160
Gene ID C20orf160
UniProt Q9NUG4
Immunogen The immunogen for anti-C20orf160 antibody: synthetic peptide directed towards the N terminal of human C20orf160
Sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSI LSLSARCLLL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C20orf160 antibody concentration is 1 mg/ml.
Description The specific function of C20orf160 is not yet known.
Characteristics Antigen Size: 433 amino acids
Molecular Weight 47kDa

Application Details

Application Notes WB Suggested Anti-C20orf160 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 20 Open Reading Frame 160 (C20orf160)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19), Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (1)