Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406234

Chromosome 11 Open Reading Frame 74 (C11ORF74) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HEPIS
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406234
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C11orf74 antibody: synthetic peptide directed towards the middle region of human C11orf74
Sequence VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKD TSPDLEKSCD
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against C11orf74. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C11orf74
Background The exact function of C11orf74 remains unknown.
Molecular Weight 25kDa
Gene ID 119710
NCBI Accession NP_620142, NM_138787
UniProt Q86VG3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C11orf74 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Chromosome 11 Open Reading Frame 74 (C11ORF74)", type "Antibodies"
Hosts (18)
Reactivities (17), (12), (12)
Applications (10), (9), (5), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1)
Beacon