Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12) antibody

Antigen: Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12)

Synonyms: MGC142941

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN406240

Additional Information

Alternative name: ALS2CR12

Gene ID: ALS2CR12

UniProt: Q96Q35

Immunogen: The immunogen for anti-ALS2CR12 antibody: synthetic peptide directed towards the N terminal of human ALS2CR12

Sequence: SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNK SFYEVINVSP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ALS2CR12 antibody concentration is 1 mg/ml.

Description: The exact function of ALS2CR12 remains unknown.

Characteristics: Antigen Size: 445 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-ALS2CR12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ALS2CR12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Hadano, Hand, Osuga et al.: "A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2." in: Nature genetics, Vol. 29, Issue 2, pp. 166-73, 2001 (PubMed).