Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406261

Coiled-Coil Domain Containing 138 (CCDC138) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC042726, 6230424H07Rik, RGD1566050, MGC115290
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406261
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCDC138 antibody: synthetic peptide directed towards the N terminal of human CCDC138
Sequence EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSK YKRRTLTSPG
Predicted Reactivity Human :100%,   Crab-eating macaque :85%,  
Characteristics This is a rabbit polyclonal antibody against CCDC138. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCDC138
Background The function of the CCDC138 protein remains unknown.
Molecular Weight 76kDa
Gene ID 165055
NCBI Accession NP_659415, NM_144978
UniProt Q96M89
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCDC138 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Coiled-Coil Domain Containing 138 (CCDC138)", type "Antibodies"
Hosts (13), (1)
Reactivities (13), (11), (11), (11), (11), (11)
Applications (9), (5), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon