Did you know that you can buy products from over 140 different suppliers from us?

Coiled-Coil Domain Containing 138 (CCDC138) (N-Term) antibody

Details for Product No. ABIN406261
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC042726, 6230424H07Rik, RGD1566050, MGC115290
Epitope
N-Term
(1), (1)
Reactivity
Human
(13), (11), (11), (11), (11), (11)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (5), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406261
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CCDC138
Sequence EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSK YKRRTLTSPG
Predicted Reactivity Human :100 %,   Crab-eating macaque :80 %,  
Characteristics This is a rabbit polyclonal antibody against CCDC138. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCDC138
Background The function of the CCDC138 protein remains unknown.
Molecular Weight 76 kDa
Gene ID 165055
NCBI Accession NM_144978, NP_659415
UniProt Q96M89
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 665 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Coiled-Coil Domain Containing 138 (CCDC138) (N-Term) antibody WB Suggested Anti-CCDC138 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406261
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top