Keratin 222 (KRT222) antibody

Antigen: Keratin 222 (KRT222)

Synonyms: KA21, KRT222P, MGC45562, MGC137294, MGC100296, 6330509G02Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN406284

Additional Information

Alternative name: KRT222P / KA21

Gene ID: KRT222P

UniProt: Q8N1A0

Immunogen: The immunogen for anti-KRT222P antibody: synthetic peptide directed towards the N terminal of human KRT222P

Sequence: ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKM DKDEEALKAA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KRT222P antibody concentration is 1 mg/ml.

Description: KRT222P belongs to the intermediate filament family. The exact function of KRT222P is not known.

Characteristics: Antigen Size: 295 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-KRT222P Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KRT222P Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Schweizer, Bowden, Coulombe et al.: "New consensus nomenclature for mammalian keratins." in: The Journal of cell biology, Vol. 174, Issue 2, pp. 169-74, 2006 (PubMed).