Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Vacuolar Protein Sorting 37 Homolog A (S. Cerevisiae) (VPS37A) antibody

Antigen

Vacuolar Protein Sorting 37 Homolog A (S. Cerevisiae) (VPS37A)

Synonyms AW261445, D8Ertd531e, 2210018P21Rik, 4930592A21Rik, MGC116266, fb08f03, fj42c03, zgc:73244, zgc:77637, wu:fb08f03, wu:fj42c03, MGC137205, HCRP1, PQBP2, FLJ32642, FLJ42616, MGC115147
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406291
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name VPS37A
Gene ID VPS37A
UniProt Q8NEZ2
Immunogen The immunogen for anti-VPS37A antibody: synthetic peptide directed towards the N terminal of human VPS37A
Sequence SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHS SIAEIQKDVE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-VPS37A antibody concentration is 1 mg/ml.
Description VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.
Characteristics Antigen Size: 397 amino acids
Molecular Weight 44kDa

Application Details

Application Notes WB Suggested Anti-VPS37A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Signaling
Restrictions For Research Use only

Publications

Product Eastman, Martin-Serrano, Chung et al.: "Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding." in: The Journal of biological chemistry, Vol. 280, Issue 1, pp. 628-36, 2004 (PubMed).

Alternatives

Alternatives for antigen "Vacuolar Protein Sorting 37 Homolog A (S. Cerevisiae) (VPS37A)", type "Antibodies"
Hosts Rabbit (11)
Reactivities Human (9), Mouse (Murine) (4), Rat (Rattus) (4), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (11), ELISA (9), Immunohistochemistry (IHC) (9), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Conjugates Biotin (1)
Epitopes C-Term (1), N-Term (1)