Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 22 Open Reading Frame 25 (C22orf25) antibody

Antigen

Chromosome 22 Open Reading Frame 25 (C22orf25)

Synonyms DKFZp761P1121, MGC68627, MGC88919, C22orf25, MGC137947
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Zebrafish, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406317
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C22orf25
Gene ID C22orf25
UniProt Q6ICL3
Immunogen The immunogen for anti-C22orf25 antibody: synthetic peptide directed towards the N terminal of human C22orf25
Sequence MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFW GNNNEILSGL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C22orf25 antibody concentration is 1 mg/ml.
Description The exact functions of C22orf25 remain unknown.
Characteristics Antigen Size: 276 amino acids
Molecular Weight 31kDa

Application Details

Application Notes WB Suggested Anti-C22orf25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 22 Open Reading Frame 25 (C22orf25)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Mouse (Murine) (18), Rat (Rattus) (18), Zebrafish (Danio rerio) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (2), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (2), N-Term,AA 1-30 (1)