Chromosome 8 Open Reading Frame 84 (C8orf84) (Middle Region) antibody

Details for Product No. ABIN406322
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C8orf84, RPESP, Gm106, Rpesp, RGD1559717, C14H8orf84
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(3), (1), (1), (1), (1)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5)
Pubmed 1 reference available
Catalog no. ABIN406322
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RPESP
Sequence LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCS CPAVHSFIFI
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against RPESP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RPESP
Background RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.
Molecular Weight 29 kDa
Gene ID 157869
NCBI Accession NM_153225, NP_694957
UniProt Q8IVN8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 264 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 8 Open Reading Frame 84 (C8orf84) (Middle Region) antibody WB Suggested Anti-RPESP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human heart
Background publications Wistow, Bernstein, Wyatt et al.: "Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants." in: Molecular vision, Vol. 8, pp. 205-20, 2002 (PubMed).

Hosts (5)
Reactivities (3), (1), (1), (1), (1)
Applications (5)
Epitopes (2), (1)
back to top