Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406322

Chromosome 8 Open Reading Frame 84 (C8orf84) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C8orf84, RPESP, Gm106, Rpesp, RGD1559717, C14H8orf84
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406322
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPESP antibody: synthetic peptide directed towards the middle region of human RPESP
Sequence LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCS CPAVHSFIFI
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against RPESP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RPESP
Background RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.
Molecular Weight 29kDa
Gene ID 157869
NCBI Accession NP_694957, NM_153225
UniProt Q8IVN8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPESP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wistow, Bernstein, Wyatt et al.: "Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants." in: Molecular vision, Vol. 8, pp. 205-20, 2002 (PubMed).

Alternatives for antigen "Chromosome 8 Open Reading Frame 84 (C8orf84)", type "Antibodies"
Hosts (6)
Reactivities (4), (1), (1), (1), (1)
Applications (6), (3)
Epitopes (2), (1), (1)
Beacon