Chromosome 8 Open Reading Frame 84 (C8orf84) antibody

Antigen: Chromosome 8 Open Reading Frame 84 (C8orf84)

Synonyms: RPESP, FLJ40021, Rpesp, RGD1559717

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN406322

Additional Information

Alternative name: RPESP

Gene ID: RPESP

UniProt: Q8IVN8

Immunogen: The immunogen for anti-RPESP antibody: synthetic peptide directed towards the middle region of human RPESP

Sequence: LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCS CPAVHSFIFI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RPESP antibody concentration is 1 mg/ml.

Description: RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Characteristics: Antigen Size: 264 amino acids

Molecular Weight: 29kDa

Application Details

Application Notes: WB Suggested Anti-RPESP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RPESP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human heart

Publications

Product: Wistow, Bernstein, Wyatt et al.: "Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants." in: Molecular vision, Vol. 8, pp. 205-20, 2002 (PubMed).