F-Box and Leucine-Rich Repeat Protein 16 (FBXL16) (Middle Region) antibody

Details for Product No. ABIN406327
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C16orf22, Fbl16, c380A1.1, Scirr1, BC042620, VIER F-box proteine 2
Epitope
Middle Region
(8), (7), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(30), (19), (19), (13), (12), (12)
Host
Rabbit
(32)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (14), (10), (10), (5), (1)
Pubmed 1 reference available
Catalog no. ABIN406327
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FBXL16
Sequence GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQ HLPRCLVIE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against FBXL16. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FBXL16
Background FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1, MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).
Molecular Weight 52 kDa
Gene ID 146330
NCBI Accession NM_153350, NP_699181
UniProt Q8N461
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 479 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-F-Box and Leucine-Rich Repeat Protein 16 (FBXL16) (Middle Region) antibody WB Suggested Anti-FBXL16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
Background publications Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16...." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Hosts (32)
Reactivities (30), (19), (19), (13), (12), (12)
Applications (23), (14), (10), (10), (5), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (1), (1)
back to top