Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

F-Box and Leucine-Rich Repeat Protein 16 (FBXL16) antibody

Antigen

F-Box and Leucine-Rich Repeat Protein 16 (FBXL16)

Synonyms Fbl16, C16orf22, FLJ33735, MGC33974, c380A1.1, Scirr1, BC042620, MGC148684, VIER F-box proteine 2
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406327
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name FBXL16
Gene ID FBXL16
UniProt Q8N461
Immunogen The immunogen for anti-FBXL16 antibody: synthetic peptide directed towards the middle region of human FBXL16
Sequence GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQ HLPRCLVIE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-FBXL16 antibody concentration is 1 mg/ml.
Description FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1, MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Characteristics Antigen Size: 479 amino acids
Molecular Weight 52kDa

Application Details

Application Notes WB Suggested Anti-FBXL16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only

Publications

Product Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Alternatives

Alternatives for antigen "F-Box and Leucine-Rich Repeat Protein 16 (FBXL16)", type "Antibodies"
Hosts Rabbit (32)
Reactivities Human (31), Mouse (Murine) (21), Rat (Rattus) (20), Cow (Bovine) (18), Dog (Canine) (18)
Applications Western Blotting (WB) (17), Immunofluorescence (IF) (15), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (4), C-Term (2), Internal Region (1)