Transmembrane Protein 161B (TMEM161B) (N-Term) antibody

Details for Product No. ABIN406328
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810446P07Rik, AI843389, RGD1309660, id:ibd2207, wu:fc31d04, zgc:63626, FLB3342, PRO1313
Epitope
N-Term
(3)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(3), (1), (1), (1), (1)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5)
Pubmed 1 reference available
Catalog no. ABIN406328
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM161B
Sequence ESKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDF TVAATVVYLV
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Chicken : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against TMEM161B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM161B
Background The exact functions of TMEM161B remain unknown.
Molecular Weight 55 kDa
Gene ID 153396
NCBI Accession NM_153354, NP_699185
UniProt Q8NDZ6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 487 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Protein 161B (TMEM161B) (N-Term) antibody WB Suggested Anti-TMEM161B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (5)
Reactivities (3), (1), (1), (1), (1)
Applications (5)
Epitopes (3)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top