Did you know that you can buy products from over 140 different suppliers from us?

Serine/threonine-Protein Kinase NIM1 (NIM1) (Middle Region) antibody

Details for Product No. ABIN406329
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E130304F04Rik
Epitope
Middle Region
(12), (7), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(15), (13)
Host
Rabbit
(19), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (13), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406329
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MGC42105
Sequence LSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVS AVKHMHENQI
Predicted Reactivity Rat :100 %,   Dog :100 %,   Mouse :100 %,   Human :100 %,   Bovine :80 %,  
Characteristics This is a rabbit polyclonal antibody against MGC42105. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MGC42105
Background The exact functions of MGC42105 remain unknown.
Molecular Weight 49 kDa
Gene ID 167359
NCBI Accession NM_153361, NP_699192
UniProt Q8IY84
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 436 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Serine/threonine-Protein Kinase NIM1 (NIM1) (Middle Region) antibody WB Suggested Anti-MGC42105 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Jaleel, McBride, Lizcano et al.: "Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate." in: FEBS letters, Vol. 579, Issue 6, pp. 1417-23, 2005 (PubMed).

Validation Images
back to top