Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406329

Serine/threonine-Protein Kinase NIM1 (NIM1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E130304F04Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406329
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MGC42105 antibody: synthetic peptide directed towards the middle region of human MGC42105
Sequence LSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVS AVKHMHENQI
Predicted Reactivity Rat :100%,   Dog :100%,   Mouse :100%,   Human :100%,   Bovine :85%,  
Characteristics This is a rabbit polyclonal antibody against MGC42105. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MGC42105
Background The exact functions of MGC42105 remain unknown.
Molecular Weight 49kDa
Gene ID 167359
NCBI Accession NP_699192, NM_153361
UniProt Q8IY84
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MGC42105 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jaleel, McBride, Lizcano et al.: "Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate." in: FEBS letters, Vol. 579, Issue 6, pp. 1417-23, 2005 (PubMed).

Alternatives for antigen "Serine/threonine-Protein Kinase NIM1 (NIM1)", type "Antibodies"
Hosts (11), (2)
Reactivities (12), (8)
Applications (12), (6), (1), (1)
Epitopes (6), (2), (1), (1), (1)
Beacon