Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406362

Family with Sequence Similarity 116, Member A (FAM116A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AFI1A, FAM116A, A630054L15Rik, Fam116a, mFLJ00229, RGD1306064, fam116a, fam116aa, zgc:103543
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406362
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM116A antibody: synthetic peptide directed towards the middle region of human FAM116A
Sequence KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILR RYFLELTQSF
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against FAM116A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM116A
Background FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.
Molecular Weight 67kDa
Gene ID 201627
NCBI Accession NP_689891, NM_152678
UniProt Q8IWF6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM116A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 116, Member A (FAM116A)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5), (2)
Epitopes (1), (1)
Beacon