Family with Sequence Similarity 116, Member A (FAM116A) (Middle Region) antibody

Details for Product No. ABIN406362
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AFI1A, FAM116A, A630054L15Rik, Fam116a, mFLJ00229, RGD1306064, fam116a, fam116aa, zgc:103543
Epitope
Middle Region
(1)
Reactivity
Rat (Rattus), Mouse (Murine), Zebrafish (Danio rerio), Human, Chicken
(4)
Host
Rabbit
(4), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (1)
Pubmed 1 reference available
Catalog no. ABIN406362
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FAM116A
Sequence KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILR RYFLELTQSF
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against FAM116A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM116A
Background FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.
Molecular Weight 67 kDa
Gene ID 201627
NCBI Accession NM_152678, NP_689891
UniProt Q8IWF6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 608 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 116, Member A (FAM116A) (Middle Region) antibody WB Suggested Anti-FAM116A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (4), (1)
Reactivities (4)
Applications (5), (1)
Epitopes (1)
back to top