ClpB Caseinolytic Peptidase B Homolog (E. Coli) (CLPB) antibody

Antigen: ClpB Caseinolytic Peptidase B Homolog (E. Coli) (CLPB)

Synonyms: Skd3, AL118244, SKD3, HSP78, FLJ13152

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN406373

Additional Information

Alternative name: CLPB

Gene ID: CLPB

UniProt: Q9H078

Immunogen: The immunogen for anti-CLPB antibody: synthetic peptide directed towards the middle region of human CLPB

Sequence: ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYN VHYGARSIKH

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CLPB antibody concentration is 1 mg/ml.

Description: CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Characteristics: Antigen Size: 707 amino acids

Molecular Weight: 78kDa

Application Details

Application Notes: WB Suggested Anti-CLPB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-CLPB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).